PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim07g042260.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 1138aa    MW: 127850 Da    PI: 6.7067
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim07g042260.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.1e-23126227199
                         EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkl 84 
                         f+k+lt sd++++g +++p++ ae++       ++++++  +l+ +d++ ++W++++iyr++++r++lt+GW+ F ++++L++gD+v+F +
  Sopim07g042260.0.1 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldyaMQPPAQ--ELMARDLHDQTWTFRHIYRGQPKRHLLTTGWSVFISSKRLCAGDSVLFIR 214
                         99******************************5444444..8************************************************4 PP

                         -SSSEE..EEEEE-S CS
                  B3  85 dgrsefelvvkvfrk 99 
                           +++ +l++++ r+
  Sopim07g042260.0.1 215 --DEKSQLLLGIKRT 227
                         ..4666678888775 PP

2Auxin_resp123.31.8e-40252334183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+++s+F+++YnPras+seFv++++k++ka++ +vs+GmRf+m+fete+s  rr++Gt++gvsdldp+rW+ S+Wr+L+
  Sopim07g042260.0.1 252 AAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYAQVSLGMRFRMMFETEESGVRRYMGTITGVSDLDPIRWKSSQWRNLQ 334
                         79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019368.76E-43116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.4E-40118241IPR015300DNA-binding pseudobarrel domain
CDDcd100173.98E-18125226No hitNo description
PfamPF023626.0E-20126227IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026126228IPR003340B3 DNA binding domain
SMARTSM010193.6E-22126228IPR003340B3 DNA binding domain
PfamPF065071.4E-35252334IPR010525Auxin response factor
PfamPF023091.0E-810011097IPR033389AUX/IAA domain
PROSITE profilePS5174527.52910111095IPR000270PB1 domain
SuperFamilySSF542772.21E-910121089No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1138 aa     Download sequence    Send to blast
MKAPSNGYLP NSGEGERKLM NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
TDGIPSYPNL PSKLICMLHN VTLHADTETD EVYAQMTLQP VNKYDQEALL LSEMGLKQNR  120
QPAEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDYAMQ PPAQELMARD LHDQTWTFRH  180
IYRGQPKRHL LTTGWSVFIS SKRLCAGDSV LFIRDEKSQL LLGIKRTNRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPLA KYNKAMYAQV SLGMRFRMMF  300
ETEESGVRRY MGTITGVSDL DPIRWKSSQW RNLQVGWDES TAGERPSRVS IWDIEPVVTP  360
FYICPPPFFR PKFPKQPSFP GDESDIENVL KRGMPWINDE LGLKDAQNSI FPGLSLVQWM  420
SMQQNNHVPV AQSGLPSVLH SNIGSDDHSK LLNFQSPALA TPGLQFNKPN QLNQPFGQIQ  480
QPPLAWTQQQ QQSLQSPVSA QQQQQQQHTL QQQQQQQQHT LQQQQQQRHT LQQQQQQQTL  540
QQQQQQHQQQ HTLQQQQQQQ HTLQHQQQHT LQQPQQHMLQ QQPQFHQQAQ QQLQQQQRPS  600
QQQQLTGNSS PVNRCVSPNQ IPNQTFPQAA VYGQLQQQQV LSASTQSQQN VPVSRNSFPS  660
TSLAQDFQFQ QQMEQQSNLL QKSQQQQTIP QQAPLQLLQQ SLMQRSQVQP SSQQSLTEQQ  720
LQLQLLNKLQ QQQQQQQAQL LSPVSSTLEP RMPQQQQNRQ PQELQFAHQQ LSSNIVTTVT  780
HLQSTHHAFN QLQNHHKSPV TIKALSGGTE GDAPSCSTSP STNNFQVSPP NFLTRNQGQA  840
ILVDESVVDP SQEQNKSECR IKHELVFSKG SELSKYKGNN TENLEAASST TSYGLDSSGF  900
NFSLPALCVD GDVQSHSRNI LPSAANNIDG LNPDALLSRD YDSGKDIQNL FSPFGNAPRD  960
IETELSDAGI NSQQFGVPNM SYKPRCANDL AVNDNGILNN NAWTNQTQRM RTYTKVQKRG  1020
SVGRTIDVTR YIGYDELRHD LARMFGIEGQ LEDPQRTEWK LVYVDHENDI LLVGDDPWEE  1080
FVSCVQSIKI LSCAEVQQMS LNGDLGNVPV PNQASSGTDS GNAWKGHYDD NSAASFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1721535545388Auxin response factor 5
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1215450.0EF121545.1 Solanum lycopersicum auxin response factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004243692.10.0PREDICTED: auxin response factor 7
SwissprotQ8RYC80.0ARFS_ARATH; Auxin response factor 19
TrEMBLK4CE890.0K4CE89_SOLLC; Auxin response factor
STRINGSolyc07g042260.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13022465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19